SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA09G0037900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ORGLA09G0037900.1
Domain Number - Region: 127-185
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0305
Family Myb/SANT domain 0.066
Further Details:      
 
Domain Number - Region: 28-106
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0471
Family beta-sandwich domain of Sec23/24 0.018
Further Details:      
 
Domain Number - Region: 186-230
Classification Level Classification E-value
Superfamily HMG-box 0.0775
Family HMG-box 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA09G0037900.1
Sequence length 527
Comment pep:known scaffold:1.0:Oglab09_0066:334102:335768:1 gene:ORGLA09G0037900 transcript:ORGLA09G0037900.1
Sequence
MGPRPPGGSSDKKSCQNVTPDKDSSMNFCHQQYPQHLFSQPPYAMNFPFPPFPHYPPYTQ
NLQYAVPPQYAPYTLPPPAGAMPSPFLPAPVIPSKALSDQGTPRSVTGPGEQGTDNAEPE
KATKRLYWTEKEDIRLISAWLIYYKTDRYWEKVVAEYNSTIPATRRRELQHVKGHWHKIF
RKVAHFHDCWCRVKAKYPSGHSEGMQLMDKTWLMYNEEARVMYLEEAEHNFAFDHCWKAV
WNQPKWKAYMSCLFTKRTLQSDSWEYMSSSEDSEEMPGKEIGEEVCMTSKEAKVKRSTSS
SEMQEDMLIKNPEELTEVEPSISNEKLLLASLKQQDACTKDTGISKKQSELLTADTSWPT
GFRLVDTSELNEHQQGLAVRDDMLEKESRPQGFDAQDNERATRENIPRKETQPRICKAPK
FSRKRKGKASSSSCEVQEDIKHAMHLQTMLNNDRVKMSEVQLRLSKEQLELARIKQEEAR
EKKETTLYKKYTELLLADTSRFDEFQKAEYEKALRHIGGMLFSKDGN
Download sequence
Identical sequences I1QMV0
ORGLA09G0037900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]