SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA09G0111600.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA09G0111600.1
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000017
Family 7-Fe ferredoxin 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA09G0111600.1
Sequence length 81
Comment pep:novel scaffold:1.0:Oglab09_0162:147005:147250:1 gene:ORGLA09G0111600 transcript:ORGLA09G0111600.1
Sequence
MSHSVKIYDTRIGCTQCARACPINVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESAYPT
DFLSVRVYLGPETTRSIALSY
Download sequence
Identical sequences I1QPY7
ORGLA09G0111600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]