SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA09G0144900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA09G0144900.1
Domain Number 1 Region: 11-116
Classification Level Classification E-value
Superfamily ARID-like 3.14e-32
Family ARID domain 0.0006
Further Details:      
 
Domain Number 2 Region: 219-291
Classification Level Classification E-value
Superfamily HMG-box 1.44e-19
Family HMG-box 0.0012
Further Details:      
 
Weak hits

Sequence:  ORGLA09G0144900.1
Domain Number - Region: 197-210
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA09G0144900.1
Sequence length 301
Comment pep:novel scaffold:1.0:Oglab09_0186:2267:4027:-1 gene:ORGLA09G0144900 transcript:ORGLA09G0144900.1
Sequence
MAEKLLYPPPLLSHEEVANDRAAFMDTLRRFHSLMGTKFMIPVIGGKEMDLHALYVEVTS
RGGLAKVMEERKWREVMARFSFPATTTSASYVLRRYYLSLLHHYEQVYFFRAHGALLRPA
ASALTKTPRRKMRGTSDQSPAAAEAGKRMALPERLGGEPCSFSVTGSIDGKFEHGYLVTV
KIAAETLRGVLYRVAPPPPAAAPPPPPPPPARGRRRRDPAQPRPNRSAYNFFFKEKHPEL
KATHPHREREYSRMIGDAWNRLAADDKMVYYRHSAEDKERYKREMQEYNERLKLAPSTMA
G
Download sequence
Identical sequences I1QQX0
ORGLA09G0144900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]