SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA09G0150800.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA09G0150800.1
Domain Number 1 Region: 20-101
Classification Level Classification E-value
Superfamily HMG-box 5.89e-25
Family HMG-box 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA09G0150800.1
Sequence length 128
Comment pep:known scaffold:1.0:Oglab09_0189:246023:247509:1 gene:ORGLA09G0150800 transcript:ORGLA09G0150800.1
Sequence
MKARSRSSNGGDSRLSVRKTKAEKDPNKPKRPPSAFFVFMEQFRKDYKEKHPNVKQVSVI
GKAGGDKWKSMTDADKAPFVTKAEKLKAEYTKKIDAYNNKQAGGPATSGDSDKSKSEVND
EDEGSGDE
Download sequence
Identical sequences I1QR29
ORGLA09G0150800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]