SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA12G0165000.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA12G0165000.1
Domain Number 1 Region: 122-171
Classification Level Classification E-value
Superfamily HMG-box 0.0000000301
Family HMG-box 0.0066
Further Details:      
 
Weak hits

Sequence:  ORGLA12G0165000.1
Domain Number - Region: 14-58
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00493
Family Putative zinc binding domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA12G0165000.1
Sequence length 207
Comment pep:known scaffold:1.0:Oglab12_0289:411:7820:1 gene:ORGLA12G0165000 transcript:ORGLA12G0165000.1
Sequence
MSAQIAPAEQVCYVHCNFCNTILAVSVPGNSMLNIVTVRCGHCTNLLSVNLRGLMHSAPA
LQDHHHHHLQESGLSGCFRDQSGYPEFGFSAASSSSKLRLPPAAAAMVSYSQQNQQLEQA
LHARPPEKRQRVPSAYNRFIKEEIRRIKANNPDISHREAFSTAAKNWAHYPNIHFGLSPG
HEGGKKLVDVDPIPTAPSSKKIQGFYS
Download sequence
Identical sequences A0A0E0BVE4 A0A0E0FE72 A0A0E0G0X7 A0A0E0RK59 B7EXC7 B8BN25 I1R7Z4 Q2QM17
XP_015618575.1.37577 39947.LOC_Os12g42610.1 OGLUM12G20870.1 LOC_Os12g42610.1|13112.m04479|protein ORGLA12G0165000.1 LOC_Os12g42610.1|PACid:21936266 ONIVA02G03100.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]