SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0210300.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0210300.1
Domain Number 1 Region: 32-117
Classification Level Classification E-value
Superfamily HMG-box 1.96e-22
Family HMG-box 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0210300.1
Sequence length 133
Comment pep:known scaffold:1.0:Oglab01_0215:286612:289655:1 gene:ORGLA01G0210300 transcript:ORGLA01G0210300.1
Sequence
MKTRSQTAPKPLKTVRLPPVKPRPKPPPPQPQPPPSRKKGQPLVDRRRPKKPPTAFFYFM
EDFRKTYKEENPSVKSMQEVGKACGEKWNTMTFEERVKYYDIATEKRAEYEKAVAEFDKK
KESGELSEESDYD
Download sequence
Identical sequences A0A0E0C5R0 A0A0E0N0E6 A2WTJ2 I1NQG3 Q5QLQ9
39946.BGIOSIBCE003084 39947.LOC_Os01g47600.1 LOC_Os01g47600.1|PACid:21910538 ORGLA01G0210300.1 OsIBCD002832 XP_015620110.1.37577 OMERI01G22590.1 LOC_Os01g47600.1|13101.m04922|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]