SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0272900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0272900.1
Domain Number 1 Region: 85-189
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.37e-23
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0272900.1
Sequence length 681
Comment pep:novel scaffold:1.0:Oglab01_0264:293862:298032:1 gene:ORGLA01G0272900 transcript:ORGLA01G0272900.1
Sequence
MAMFGTRSYSVFGDILDAFLILLVLSTCCLSSTITTDSLLPNKQISDGQTIVSANETFTL
GFFSPGTSTYRYVGIWYSYVPNRTVVWVANRNNPVLDTSGILMFDTSGNLVILDGRGSSF
TVAYGSGAKDTEATILDSGNLVLRRVSNRSRLRWQSFDYPTDTWLQGMNLGFVGAQNQLL
TSWRSSDDPAIGDYSFGMDPNEKGDFFIWERGNVYWKSGLWNGQSYNFTESESMSFLYVS
NDARTTLSYSSIPASGMVSGLCLGAGQREAAKHIVHVELLASVPEIKTGKTVANAQKDLI
QEMGLDGLVEIPGEDDKCSLWYGNIMNLREGESGDAVGTFYLRLAASELESRGTPVVLIA
ATVSSVAFLIFASLIFLWMWRQKSKAKGVDTDSAIKLWESEETGSHFTSXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXHGNYGKKEGGPSSLIHPYITHVQSISNRPTMTEII
SALDNESTTLPEPKQPAFVSAGIWTEAGVHGGTHSINGMTISDTQDGPGNKCRDGVKTPL
AGSCNLQTRVTKPEIKGLFAHGQALWQPNLGENNPTIVGEIPGKRPECDRCFRRVDHRAH
NDKDAATLEIADGLPSNISSS
Download sequence
Identical sequences I1NS89
ORGLA01G0272900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]