SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0295100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0295100.1
Domain Number 1 Region: 87-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-19
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0295100.1
Sequence length 516
Comment pep:novel scaffold:1.0:Oglab01_0289:256861:260025:-1 gene:ORGLA01G0295100 transcript:ORGLA01G0295100.1
Sequence
MAMAPRCTLSVLLPVALLLCTAIASPDFPLGKNFTVPLYYQQPADLAVTTTTVLNASHGA
PLRPGVAAAISVVAGTGGLEGLSMCSLVVLLGNVTVWASDHDGGRFLVRGFCRLELTVDG
DLRLTDAAGTVGWSSATAGRRAKVLRLTRSGNLRLLDAKNQYVWQSFDKPADKLLRGQRI
GVPSYLTAPVTMIGSAFFSLELKERSITANFNVGIKRYTYWELTPRHNRSVAFAEMDVLG
LRLLDRQRRPVAQISPAIEAQVSFLALGEDGNLGMYFYDSHDMKFGPSYEALGFCELPLA
CGLRGVCSAAGECDDFSTYGVHPAPAAHRHSACNATTVADRHYMAVMEGVTMAIRPASPP
TANVTMRQCADSCLRDCSCAAALYVLAAVADHGGACSRYEMTAGAREVIGGGHRHNYLYL
VKAPRTRDSEHEHGDDDGAVSRVLTRILIGFGTLDVIGLCALTWLCAYYCIYLRDIPVLD
DKDDEEADDGGGEAARRGDAVSQSPPTNSEPVIELN
Download sequence
Identical sequences I1NSW1
ORGLA01G0295100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]