SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0400500.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0400500.1
Domain Number 1 Region: 36-274
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 7.99e-51
Family Shiga toxin, A-chain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0400500.1
Sequence length 290
Comment pep:known scaffold:1.0:Oglab01_unplaced026:32283:33155:-1 gene:ORGLA01G0400500 transcript:ORGLA01G0400500.1
Sequence
MALFLPLLVAASLFSPAAALLAGGEHGVVVVEPRQVEIMFDLATQSWYHELYRPLKAALT
DDGAGPDLMGHAVVDLLDDDQPPSKQITVRLFASGGGDEAKLLVAEDDAYVAGFANRTGH
WHTFRGGRCHHPVIIPAGGAAPCTELPFGGTYRELIGGVANLRAVPLGRASAASAMRVLS
RYDPATTPAADAKMAVAKFMVMVTEPMRLKAVSRAVGGRWEEESYLSSDEAKYVPYWGEI
SAMLVEWNSTGRWGELGPRSKMDRARCPRPAGCEDDGGDGDDGGGKLFMI
Download sequence
Identical sequences A0A0D3FMH8 I1NVW5
OBART03G29780.1 ORGLA01G0400500.1 ORGLA03G0275000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]