SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA02G0162500.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA02G0162500.1
Domain Number 1 Region: 90-173,241-262
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000972
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Weak hits

Sequence:  ORGLA02G0162500.1
Domain Number - Region: 386-421
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000981
Family Pan module (APPLE domain) 0.087
Further Details:      
 
Domain Number - Region: 239-301
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00504
Family alpha-D-mannose-specific plant lectins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA02G0162500.1
Sequence length 523
Comment pep:known scaffold:1.0:Oglab02_0210:63632:65203:1 gene:ORGLA02G0162500 transcript:ORGLA02G0162500.1
Sequence
MEAVRCFVVLCVAVAAALASLGGGAVDAAAAAAAAAQEMRRGFSVAHDRSYSQFEQVLSD
PTGVFALGFLRVNSTMLDLAVVHLPSSFPLWRAIPDRPAQWSAPASLSFDGDLVLTDPAA
NKVLWSAGAAAGAGGDRVVLLNTSNLQIQSGGGGGDGGSSPGIVWQSFDAPSETIVQGQN
LTSATALYTSDRRFSMRMGTSYFGLYIEPPASSSGGGGVAAAMYWKHTALQAKAAIVDGG
GPTYARVEPDGYLAMYQKEGPPADVLSFDTFNHGVRALRRMTLEADGNLRAYYWDSTGSR
WVLDYTAITDPCGLPSTCGAYAVCVPPSGRCACLANATDVSGCAAANVGGGGGLCGRTGG
EVGGLYWEVRRQRVEPANKEFLPFEHSPSAADCEVRCARNCSCWGAVYSNGTGYCYLMDY
PAQMMVAADERKVGYFKVRSLEEAAAASGGGRAAGVKAALLAVGVTVLVAAAAFGAYRVW
KRRCRTAVDARRQVVADDEGLSPGPYKNLGSFSSVELSSSFRR
Download sequence
Identical sequences I1P0W9
ORGLA02G0162500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]