SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA04G0094800.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA04G0094800.1
Domain Number 1 Region: 64-158,190-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.5e-29
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  ORGLA04G0094800.1
Domain Number - Region: 355-412
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00216
Family Pan module (APPLE domain) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA04G0094800.1
Sequence length 523
Comment pep:novel scaffold:1.0:Oglab04_0216:272421:273992:1 gene:ORGLA04G0094800 transcript:ORGLA04G0094800.1
Sequence
MPLLRHVLLGIVLLFLHTLASSAATDTVSPSQALAGSNRLVSNNSKFALGFLKQGNESYN
NHNSYLGIWFNKVPKLTLLWTANGDNPVVDPTSPELTISGDGNLAILDHATKSIIWSTRA
NITTNDTIAVLLNNGNLVLRSSSNSFKIFWQSFDYPTDTLFAGAKIGWDKVTGLNRRIVS
RKNSIDQAPGMYSLEVGLNGDGHLLWNSTVPYKSSGDWNGRYFGLAPEMIGVALPNFTFV
YNDQEAYFTYTLRDDTAIVHTGIDVFGRGFGGTWLEGSQDWLIHYRQPIVHCDVFAICGP
YTICDDKKDPNNNPFCDCMKGFSVKSPKDWELDDRTGGCMRNTPLSCGSSKDRSDLTDKF
YPMQSIRLPNNAENVQAATSGDQCSQVCLSNCSCTAYSYGEDGCSIWHDELYNVKQLLDA
ASDGNGVVLYVRLAAKELQISERKKSGTLIGVAIGASTGTLFLITLLLILWRIKGKWIIA
HPLEKSEDSIGIIAFRHIDLRRATKNFSEKLGEEVLVLYLKGT
Download sequence
Identical sequences I1PL79
ORGLA04G0094800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]