SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA04G0186700.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ORGLA04G0186700.1
Domain Number - Region: 181-226
Classification Level Classification E-value
Superfamily HMG-box 0.00269
Family HMG-box 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA04G0186700.1
Sequence length 238
Comment pep:known scaffold:1.0:Oglab04_0284:100400:101618:1 gene:ORGLA04G0186700 transcript:ORGLA04G0186700.1
Sequence
MPKKMGVNSKAEAARERRSVAEADRRDRVERGKEEEYWREAEGPKSRAARRREEDAEKRA
EAAARKAENRRLAEAEAASASASAPSKTAARKASRVGAPAPKVTEAELARRREDERLRLE
REAEAAKKRAARTAEEEEYERVVLVANTNRDDSIIEARSVDEAIARMSLVDSEGALPADK
HPERRLKASFKAFEEAELPKLKEEKPGLTLNQYKDMIWKLWKKSPDNPLNQVCSHKDI
Download sequence
Identical sequences I1PNU8
ORGLA04G0186700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]