SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA06G0040100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA06G0040100.1
Domain Number 1 Region: 102-246
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.33e-29
Family alpha-D-mannose-specific plant lectins 0.0021
Further Details:      
 
Weak hits

Sequence:  ORGLA06G0040100.1
Domain Number - Region: 372-420
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000628
Family Pan module (APPLE domain) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA06G0040100.1
Sequence length 561
Comment pep:novel scaffold:1.0:Oglab06_0018:156418:159384:-1 gene:ORGLA06G0040100 transcript:ORGLA06G0040100.1
Sequence
MGKGGSGVPQIRCEGGGRRSSPSPGALLLRGPWRSSRGILIIWADPSVISFLLMLPTAVA
KDQKSFLTRRSSISTQDDTTAILVSPNDDFSCGFYKVATNAFTFSIWFSRSSEKTVAWTT
NRDAPVNGKGSRLTFQNDGTLALLDYNGKVVWSTNTTATPANRAELLNNGNLVVMDLQGQ
HLWRSFDSPTDTLLPLQPITRNVKLVSASARGLLYSGFYNFLFDSNNILTLVYNGPDTAS
IYWPNPSVHLPWKNGRTTYDSRRYGVLNQTGRFVSRDLFKFEDSDLGDHVMRRLTLDYDG
NLRLYSLNETSGNWSVSWMAFSRVCQMHGVCGFEVIDPSDWSKGCKRKADMTVIWDKGNR
TNTNNTISRDFSFRKNTGTDFWGYDMDYAESVPFSNCRNMCLANAKCQAFGYRRGTGLCY
PKYTLFNGRSFPDPYNDIYLKVSKGVPFTKESDSRLTHSCGVTEKLAYPSSQMLEDVPSK
FVFGYFLSSLLTVLLIEVVLIVAGFSVVKKWETIPEITDKGYMIISSQFRRFSYKELHKA
TNCFQEEREWWIRCGLQGSPR
Download sequence
Identical sequences I1PZT8
ORGLA06G0040100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]