SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA06G0151100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA06G0151100.1
Domain Number 1 Region: 113-204
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-26
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA06G0151100.1
Sequence length 378
Comment pep:novel scaffold:1.0:Oglab06_0164:5501:11875:1 gene:ORGLA06G0151100 transcript:ORGLA06G0151100.1
Sequence
MMLLSAVPGAIILLVGGSLLAQCLDPTLPAANTSSSWTNSADDQIRYGDGSIVRVVLLLS
HSHGASSDDAAFACGFFCGAPCDRKSFLFGVFLVSTNSTGGVAAAAAAPPPVVVWSANRD
RPVRDNATLQLSDAGDLVLRDAVGAFVWSTNTSAGHAVTGVRLSDSGNLVLFDDSGSPVW
QSFDHPADVLLPGQYLRPGMRLTVNALAADFSEGSLYVSVGNNAMSGFVGHNPPQLYFTA
PVSDTMDTLANTMDAPVSISAFGRSPSSSSEILISLPVAHSVQYIRAVSDGHMRLYGWNS
SSWVIMYEVLQKYTPAVTASTRWLVAAMASALVPGIAVAHQRFIPLQSTEIGLVSDVSWR
RRFLAGMYEVLKWWSFQM
Download sequence
Identical sequences I1Q2Z8
ORGLA06G0151100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]