SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA07G0128400.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA07G0128400.1
Domain Number 1 Region: 46-257
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.85e-20
Family BAR domain 0.048
Further Details:      
 
Domain Number 2 Region: 282-344
Classification Level Classification E-value
Superfamily SH3-domain 1.22e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA07G0128400.1
Sequence length 348
Comment pep:known scaffold:1.0:Oglab07_0118:129228:134163:-1 gene:ORGLA07G0128400 transcript:ORGLA07G0128400.1
Sequence
MDVLRKQASKFKEQVAKQQQAVIKQFSTTGYEHSDAVVIDEVELQRHQQLEKLYTSTRSG
RDFQKDIVRAAEGLVSIGIRHVEVGTKFSEDCYRYGGESSASDEALAKAASLYGGALRNV
EKEYEEFNRILSSQTIDPLRAMAAGAPLEDARGLAQRYSRMRHEAEILSAEIARRKQRVR
EAPLAEHTTKLQQSESKMIEHKASMAVLGKEAAAALAAVESQQQRITLQRLVGMVEAEKL
FHLRLAAILDDVEAEMSSEKQKRESAPPTIHSHKRAEKAQYFLAEAVHNFNGTTEKELSL
IVGDYVVVRQIAPNGWAEGECKGVAGWFPAAYVERRENIPPNKVFPQA
Download sequence
Identical sequences A0A0D3GRF9 A0A0E0AKD5 A0A0E0I1T1 A0A0E0Q8S9 I1QAZ2 Q8LIJ9
ONIVA07G15510.1 LOC_Os07g32460.1|PACid:21899639 LOC_Os07g32460.1|13107.m03291|protein ORGLA07G0128400.1 39947.LOC_Os07g32460.1 OBART07G15720.1 XP_015647585.1.37577 OGLUM07G15410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]