SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA07G0159500.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ORGLA07G0159500.1
Domain Number - Region: 25-198
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0502
Family FCH domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA07G0159500.1
Sequence length 608
Comment pep:known scaffold:1.0:Oglab07_0138:170065:172506:-1 gene:ORGLA07G0159500 transcript:ORGLA07G0159500.1
Sequence
MATEDTSHISGSSESTIPLLEQLAEVFGKLKSHTETSLQLQNGINWEDIKAHFLNLEKSY
KSKCDELAEKQKALEEKKAESCRLIAEKEANVSAKERAFLNQFQELRDTAVSALSEVRQK
YKVELAGILDANGSKDKKVRTSTNDMNALCASEENTTASGLGEPSEASPVDVKPRPVLKQ
LCEQMDTAGLLKFLSENWKKLSSLRDELSAALRCATDPARFVLGSLEGFFPSDHTSSPGN
KQIILQGQRRSCIILMEAITPALATKEPGDNHPWSSEIRELAKAIAEEWKSKLAEVDLDA
SDGYSLEAQAFLQLLTTFNVDSVLDEDELCKLVVAVSRRKQTAELCRSLCLNERIPDIIK
ELVNRHRQIDAVQFIHAFGLSESFPPAPLLKTYVEELKDSLGNNGDGNAASLKDDPKTRE
LLALRAVIKCIEEYKLQKDYPLGPLQKRVAELKSKGEKRPLEAGRHNAKKPRTFGNSAAR
RPPNPVGSAGRRPSGPAGTWQRPPPPMPSYPDRYGHADRYHYTAPSATYDPPAYASYSEP
YSASKPYQYTPGSVAPASYNSNQFKVAYGGPGAPPTAGGYGSYNDAAGQSTSSSYSGYSG
YHPSLPRL
Download sequence
Identical sequences I1QBV3 Q7XIP0
LOC_Os07g40270.1|13107.m04185|protein XP_015647752.1.37577 ORGLA07G0159500.1 39947.LOC_Os07g40270.1 LOC_Os07g40270.1|PACid:21900636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]