SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA08G0060300.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA08G0060300.1
Domain Number 1 Region: 63-160
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000089
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Weak hits

Sequence:  ORGLA08G0060300.1
Domain Number - Region: 183-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0762
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA08G0060300.1
Sequence length 430
Comment pep:novel scaffold:1.0:Oglab08_0032:12123:13415:1 gene:ORGLA08G0060300 transcript:ORGLA08G0060300.1
Sequence
YLPPLLRLLLLLSWTPATLCCMTPKNRSYGLPLVLRRTPYDQGRTCLLAISCSQVSLTPT
MPQESIAFPTSHDGNLVMYPIGTIDPDSAYWNTGTYAQNFLLTLTLDPNGTLWLFDRNSP
YRMVLFLTNQSLSASPDSESYYHLTLDADGILRLYSHVFFKQGGAHKTKVEWLVPPSNDR
CNVKGVCGPNSFCQVTSSGETSCSCLPGFEFLSANQSTQGCWRAQTGGCTRNSPNGDIGL
VATMVTVKKTSWSDRSYNIPPQSPTIEECKAICMSDCACEIAMFDSYCSKQMLPIRYGKR
VPGSNTTLFVKVYSYEPKRTASATSTAMLTHGAALAMLSLVLLSVSVMLCKRRPFLRYTR
AAQHHETEFDEENIGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXQ
Download sequence
Identical sequences I1QGQ2
ORGLA08G0060300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]