SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA09G0150100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA09G0150100.1
Domain Number 1 Region: 59-159,192-221
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.94e-29
Family alpha-D-mannose-specific plant lectins 0.0034
Further Details:      
 
Weak hits

Sequence:  ORGLA09G0150100.1
Domain Number - Region: 358-398
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00942
Family Anti-platelet protein 0.081
Further Details:      
 
Domain Number - Region: 171-275
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0893
Family PepX C-terminal domain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA09G0150100.1
Sequence length 467
Comment pep:novel scaffold:1.0:Oglab09_0189:173321:174902:-1 gene:ORGLA09G0150100 transcript:ORGLA09G0150100.1
Sequence
MNWIAFNYLTTAILLLLPACVADDQLVPGKPLSIGSTVISNGGAFALGFFSPTNSTSSNL
YLGIWYNDISPLTVVWVANRETPAKDGGHGSSSSAPSLTLSNSSGLVLADGDGRFLWTTD
ISIIEASSPAVAVLMNTGNLVVRSPNGATLWQSFDHPTDTYLPGMKIGINYRTRAGERLL
SWNDGPGDPSPGSFSFGGDPDTFLQLFIWNQSRPYWRSPVWTGNPIPSQLMVNGTTVIYL
SVVDADDEIYLSFGISDRAPRTRYVLTNSGKLQVLSWDGGDGASEWSKLGELPKYECEHY
GYCGPYGYCYYSEVAPTCECLDGFEPRSKEEWSNGRFSRGCRRTEELPCGGDGGDAVFLE
MQGMQLPDKFVRVRNKTFHECAAECAGDCSCTAYAYANLGGSGSARKDATRCLVWLGELI
DTQKVGPDWVPWGIVGGETLYLKAAGFTGLKSRRISGRSLHVSFIIA
Download sequence
Identical sequences I1QR22
ORGLA09G0150100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]