SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA10G0022900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA10G0022900.1
Domain Number 1 Region: 106-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000851
Family alpha-D-mannose-specific plant lectins 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA10G0022900.1
Sequence length 372
Comment pep:known scaffold:1.0:Oglab10_0037:125332:126450:1 gene:ORGLA10G0022900 transcript:ORGLA10G0022900.1
Sequence
MALLPCIAIAVLLSSSLVAAVTGPPGTIERVVKQQILASIPPGGHGAGDVHPPVLFLTSP
SGKYAAYFVRSHTVPGAGGLGADFCYVEVVVNKGGEGDAAAGGGMSVWESECRPVSTVNT
CTLLFSWHGLEVFDGSQEVWHGETNTDGTNFLQRLELVDDGDMRIRDKDGELAWRASDEP
RHAQHCGAPGSPGLATAFPPFAEPIGAHSSDLPFGMFPGGNGRAAELPQAADAAAGALGG
VGAVAPLPGAVGGAGAVAPLPGAAGGDAAAAPLPGDMGGDAALAPLPGALGGVDPAFSPL
PGDLPDPAAAAAAGGAAAGVGGVGAGALGAGAVGAFGSQPLVDNSPYDSGAWKVDGHLAA
IVVALGVVLGAI
Download sequence
Identical sequences I1QSP6
ORGLA10G0022900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]