SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA10G0167400.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA10G0167400.1
Domain Number 1 Region: 45-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.19e-24
Family Arfaptin, Rac-binding fragment 0.063
Further Details:      
 
Domain Number 2 Region: 299-361
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-17
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA10G0167400.1
Sequence length 370
Comment pep:known scaffold:1.0:Oglab10_unplaced086:309:3340:1 gene:ORGLA10G0167400 transcript:ORGLA10G0167400.1
Sequence
MEAIRKQASKLREQVARQQQAVMKQFGGGYGADGAFADEAEAQQHSKLEKLYISTRAAKH
FQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGAENTCTSGSTLSKAALCFAKARSLME
KERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQAIEVSKRQMKLRE
TSGNGDMISRLEAAESKLQELKSNMGVLGKEAVASMTAVEAQQQRLTLQRLIAMVESERS
YHQRVLQILDQLEREMVSERQRIEGAPPPAVESSMPPPPSYEEINGVFMRNPTVAELVET
VEFFLAEAIQSYRAESETELNLAAGDYIVVRKVSNNGWAEGERRGKAGWFPYDYIEKRDR
VLASKVAQVF
Download sequence
Identical sequences I1QWU1
ORGLA10G0167400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]