SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000078 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000078
Domain Number 1 Region: 134-367
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.11e-54
Family Regulator of chromosome condensation RCC1 0.025
Further Details:      
 
Domain Number 2 Region: 780-885
Classification Level Classification E-value
Superfamily POZ domain 2.25e-20
Family BTB/POZ domain 0.0057
Further Details:      
 
Domain Number 3 Region: 541-646
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000152
Family BTB/POZ domain 0.027
Further Details:      
 
Domain Number 4 Region: 36-127
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000115
Family Ankyrin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000000078
Domain Number - Region: 339-461
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0152
Family beta-lactamase inhibitor protein-II, BLIP-II 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000078   Gene: ENSONIG00000000065   Transcript: ENSONIT00000000078
Sequence length 1371
Comment pep:novel scaffold:Orenil1.0:GL831268.1:593274:612730:-1 gene:ENSONIG00000000065 transcript:ENSONIT00000000078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQAPLDCTPKCRSQQHADQVVAALTSGSEGQLRAFLTSHCHNAATLRDAFGRTALHLAA
SLGKKALLEWLLEIKSADLMLKDKESGWTALHRSAFYGQIHCLISLVKHGGLLSTQDKEG
LSVLDLTMKDRPSHVLFRNTDPTEVYTWGNNTNFSLGHGNQESRQHPELVDVFARTGVYI
KQVVLCKFHSVFLSQKGQVFTCGHGQGGRLGHGDEQTYLVPRMVEGLMSHHCSQVAAAKD
HTVVLTEEGYVYTFGLNTFHQLGLVPPPASAFVPKQVFSKMLKGRTVIGVAAGRFHTVLW
TREAVYTMGLNGGQLGYLLDPNGEKCVTAPRQVSALHHKDVAISMAAASDGATVVVTEKG
DVYLLADYQCKKMASRQLNIRKVLVSGGSLDHRVAPQILNEGGVEKVVILALDTAGRVFC
WRSTGSSVRQCRWAYARQVFMTDIALSKNSMMFVTQDGEGFSGVWAGEYKKYGEKKGEEF
MGEKEGSVEVCGHSDVGTLYERIRLEKLPYVHRAVSITMDSKGRNFGVLQADPKTSLYEV
PSISPSSFSQHFGSLLDEADEMDSIHDVTLQAGDRTFPAHKYILSMRSEFFRKQFMSEHC
GVDEELDKEVRKSEDAVGCDLLILEKVPPDMMEYALHFIYTDSCELLVHGARPRVSGVIT
VPNQDSEEDRLISSLQNLGLSGRSALEVYRSLPPAAKGNSDKAKSKGSKPGKKGKGSKGD
KAGANEGGANPVKTLQGVAKKLGLGSLSARLDGVKYENGKINVTNKKTGNKPKLYQKKCS
YLCDVTLKSEDGKEFSCHKSVLCARLEYFNSMLGNPWIEATSCSALEMPTSSEILQVILE
YIYTDESPTIKESLNVEFVCNVLVVADQLLITRLKEMCEVVITENLTLKNAAELLEFAIM
YNAEQLKLSCLQFIVLNMAALLESKALDILSDEVLVELSAAYRKMIPAMQKRVITPYPGA
PDLSVYEDEDLDSAFSPKPEAELDHSCREILLKKAKIKAKKKPRRRSDSSGGYTLSDIIQ
SPPAAVVSPCLVKSGKVNSTESLQELLTSDSEGSYMGVGSPRDMQSPVFHERVELELKCF
FLQDEKTFSQRLKTPPSTPTSIKNGLPTPPNSAPQTIPKCDSVFSICSPARAPPVLDLRT
IMDMEANSLQTLGATPKSPGSVSTSIKHSPLSTKLSQKQRKMLAMANKEASAESTASKPT
PTATPSKSSGKACCRATAVQSPPSSCSFRALLEEEENHLIRSGQTGTQRGQSTLGSPIVA
APAARRVTFKCAEGGESERPAGYPLRPWVLGAVGSPPLSSLVTFASIVEEEKQQEAALIR
SREKPLALIQIEERAIQDLLFHYKAHDNPDELIVVERSSRGPMAVPTWNKH
Download sequence
Identical sequences I3ITY9
ENSONIP00000000078 ENSONIP00000000078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]