SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000125 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000125
Domain Number 1 Region: 144-213
Classification Level Classification E-value
Superfamily RING/U-box 4.71e-19
Family ZZ domain 0.016
Further Details:      
 
Domain Number 2 Region: 383-431
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000587
Family UBA domain 0.00029
Further Details:      
 
Domain Number 3 Region: 30-83
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000491
Family PB1 domain 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000000125
Domain Number - Region: 107-118,203-228
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00915
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000125   Gene: ENSONIG00000000103   Transcript: ENSONIT00000000124
Sequence length 436
Comment pep:novel scaffold:Orenil1.0:GL831451.1:382845:386180:1 gene:ENSONIG00000000103 transcript:ENSONIT00000000124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTVKAYLLGKDEAVKEIRRFAVDQDVSCSFEYLSRKTADVFGNLNNFNLFYRDEDGDL
VAFSSDDELMMGLGCMKDSTFRLFIREKKEHRRDFPLHAFPPFAFGPPPPPAGGPPPPHA
GGPPPPHAGGPHAPPHGPHMGPPPPHVAPPYAMHPNVTCDGCDGPVIGTRFKCSVCPNYD
LCSSCQAKGKHTEHALLPIWHPLQWFPRGKWMKRMRHCMWNLNQNQAQNQDNDQDQNESS
PSKPAADANTPSGSQTNVDFLKNIGEGVAAMLSPLGIDVDIDVEHEGQRTKVTPPTQSGG
GEGDEEMEHTSSEGGASLGAKRSDPQVSKDSDEEWTHLSSKEVDPSTGELQSLQPDNQEQ
GPLSEGQAGPSGLREAALYPHLPQEADPRLVESLASMLSMGFTDEGGWLTRLLQAKNFDI
GAALDAIQYAKQPRPH
Download sequence
Identical sequences I3IU35
ENSONIP00000000125 XP_005463852.1.78416 ENSONIP00000000125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]