SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000139 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000139
Domain Number 1 Region: 340-417
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.27e-19
Family Intermediate filament protein, coiled coil region 0.00016
Further Details:      
 
Domain Number 2 Region: 111-145
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000418
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000000139
Domain Number - Region: 244-382
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00706
Family HBL-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000139   Gene: ENSONIG00000000113   Transcript: ENSONIT00000000138
Sequence length 730
Comment pep:novel scaffold:Orenil1.0:GL831268.1:917116:921443:-1 gene:ENSONIG00000000113 transcript:ENSONIT00000000138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFSPERISSYRRHFEDSSSSSYQIRVSSPSPTRREARRASTGCFSSRAGASSMRVDSVG
RRTVSAARRSRMVGAGVSAGAMVCVGPSGERAIDLDVAAAENQQFLSTRTSERQEMIVLN
DRLAVYIDKVRSLEQQNKLLETEIEAYQNRFEKPTGLRLLYEEQLKELKKIAEQMRVQRD
ISLAAKESAAAQLEAIKVKYEEAVELRKKAELDIEAFRPDVDKATSSRIALEKKLEQLEV
EIEFLKRIHQQEIDELMKQIYAAHVSAQSAFTLPDLAAALKQIQTQYDDIAAKNLQEMDS
WYKNKFEDLTKKTSRHVDKVRSVREELAGAKKDIQSKERDLDALRTRNEALEAKIRETQE
KYRKELEDLQARIEALQLELKSTKEKIALHLREYQELLNVKMALEIEITTYRKLIEGEDL
RLSGMMQTLSLTSCSMTAIGAGMSISGGGMGGAGGMGGGLIGRGGGGDIGGRVGMGGGMD
AGGMGAGPGTGGLGGRMGAEGTSGKKGPSGTSAGADFTGSHGLGAGVVGVGIGANAGVVG
KGNGSRAMGTGGTSGSGAGGVGNLGFGTGGKDDSSIGGTGMGGGGKTGGSGGMGGTGTGF
GGGNGGVVVGKSGGFAGGIGEDGSIARGMGGGVGGSGGSGGVGSDDVALSAASGMGKTGG
GKGGISGTGTTYGSDGHDKNIEAYGEQAVELTERRTVLIRTVKNEDDVLEMDHQEQTYTI
TGAADDSDNE
Download sequence
Identical sequences I3IU49
ENSONIP00000000139 XP_005472620.1.78416 ENSONIP00000000139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]