SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000318 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000000318
Domain Number - Region: 3-59
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0124
Family PB1 domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000318   Gene: ENSONIG00000000249   Transcript: ENSONIT00000000317
Sequence length 507
Comment pep:novel scaffold:Orenil1.0:GL831528.1:113544:119103:1 gene:ENSONIG00000000249 transcript:ENSONIT00000000317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPLRLRIILGEDDARKLILPAGTPVSIEDLWHTVKTSFGLQQDIRLQYQDEDFGNEFM
NMPDISKVKDKGTLKVIFLQSPQEEDARTSQSQATESVSISSGDTDDTEPISSSGSSPSS
RHWVWPSVFTVPQFSCDAEFELEKANTACANGGTLLNPSPKLKSQILEQLAEEIYKFEAY
PTDNDLTDDAEALVIKHPCLREQGSFNGCYGWKISLKYKMANLRTKLRGFGCTKVTINVK
KPKRAEVNYCPQHPKGETSESLEQERVAILSELTKRNNDSGFMYQDIRIIQILPRHKMLA
RAPPLDPSLSRHGLIFCEKNLMAAYCSHSTKPLLSTSFAELDQYAPSLMEIFQGKGGTPG
KKIRGLMLALSKHDNIHTRRACILKSLCIYLNEDYEKLIKEYLDTDSEAKSCMEQTVIGV
YIIQKKGAEPEDGPEDIGVLIVGVEALTDLGNIAQAYALLFGLIYCLNLTNPPEPKCIFE
VLQKILLNLDGQKLSSKAQFLKNKLKG
Download sequence
Identical sequences I3IUM8
ENSONIP00000000318 ENSONIP00000000318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]