SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000373 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000373
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily TPR-like 1.39e-29
Family Tetratricopeptide repeat (TPR) 0.0025
Further Details:      
 
Domain Number 2 Region: 136-224
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.97e-23
Family Canonical RBD 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000000373
Domain Number - Region: 265-288
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00104
Family CCCH zinc finger 0.0072
Further Details:      
 
Domain Number - Region: 100-122
Classification Level Classification E-value
Superfamily UBA-like 0.0702
Family UBA domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000373   Gene: ENSONIG00000000297   Transcript: ENSONIT00000000372
Sequence length 299
Comment pep:novel scaffold:Orenil1.0:GL831280.1:1083941:1087191:1 gene:ENSONIG00000000297 transcript:ENSONIT00000000372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEQAQYTEAVDMFTEAIFCDPKDHRLYGNRSYCHWFLEQFSAALSDARRSIRFAPDWPK
GYFRKGCALVGLKRYSEAEKALEKVLELDQNCKEASKKLFNCRVLQLMEMGFDEAQSKEL
LQKFTTVQAVVNSFEARPLKLFSQQDQSGNCRSLWVGNITQEVTEKDLCDLFKNFGEIES
IRVLHERFCAFVNFKNANMAAKALDKLQGVELGGNKLVMRYPDRWIHRTVPSMQRSNSNL
GSNTAGTQPSSAASGSRWRAPLNGDECFYWRTTGCFYGNKCRFKHLPDQQGRDKKPWQP
Download sequence
Identical sequences I3IUT3
ENSONIP00000000373 ENSONIP00000000373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]