SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000404 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000404
Domain Number 1 Region: 132-237
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 286-392
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 419-522
Classification Level Classification E-value
Superfamily SRCR-like 9.16e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 4 Region: 3-98
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000404   Gene: ENSONIG00000000320   Transcript: ENSONIT00000000403
Sequence length 523
Comment pep:novel scaffold:Orenil1.0:GL831457.1:419722:435155:1 gene:ENSONIG00000000320 transcript:ENSONIT00000000403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLTRCSGRVEVYHNNSWGTVCNNGWDLNDAEVVCRQLNCGAALQAPQSALFGAGTGHIWL
DNVTCSGNESSLTECQHSGFGAHNCVHGQIAGVICSAWFCRRFLPVKKPAKALLKASGQV
ASAALSKQRDLIRLTGSGSTRCSGRVEIYHNNIWGTVCDDGWDLNDAEVVCRELNCGTAL
EAPQTAHFGAGTGQIWLDNVACSGNESSLIECKYNQFGTHNCGHEQDAGVICSGEELLTL
NFSRSSILETRYHSQSNPSLLGSLRYKISSDIKRVLTTGWLVYVKIGPVRLVGSGSTRCA
GRVEVYHNNSWGTVCDDGWDLNDAEVVCRQLNCGTALQAPRSSYFGKGTGPIWLDNVTCS
RNEESLNECEHIGFRAHSCGHGQDAGVVCSGTEAESVLVVQDGTSQSLKIMEEIPTERLV
RLVGSGSTRCSGRVEIYHNNIWGTVCDDGWDLNDAAVICRELNCGTALEAPQSAHYGAGT
GQIWLDNVACSGNESSLIECKYNHFGTHNCGHQQDASVICSGE
Download sequence
Identical sequences I3IUW4
ENSONIP00000000404 ENSONIP00000000404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]