SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000681 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000681
Domain Number 1 Region: 105-205
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-32
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000089
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000681   Gene: ENSONIG00000000535   Transcript: ENSONIT00000000680
Sequence length 501
Comment pep:novel scaffold:Orenil1.0:GL831135.1:2163922:2173882:-1 gene:ENSONIG00000000535 transcript:ENSONIT00000000680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSDCIWYIRPGNQIIQLELSDVNVNHSTECGYDYVYVYDGSSTGSRLLGQICNNNNNNTF
YSTVGYTVCIQIVLAAQFWSYVFMFYYCQSPDFTTGSCGGNLFGSGTFSSPNYPSYYHDN
AYCMWQLRAAYDQRIFLQFTFLQLEDCCSCDYIEIYDGPYVYSPFLGKVCNNSLSTFFST
SNYMTVVFRTDGAMVGRGFNAEFSSSLTPSSGTLISRVDCSSDNMNIVIERSYLNSLGYD
GHSLYLNDPHCRPQISYYNVVFSFPLNTCGNIREFENGRIVYTNSLRAYNSNYGEITRQS
NFKLNVNCRMEQDSVSQILYEVREIDNTTITGTGRYNTSMVFYQSSSFYYQVTEFPYEIT
LNQNLFIEIDMRRGDSSLVLFIDTCIASPSAFDFQSRPYYLVRNGCPVDNTYYAYTTGTS
PFARFTFKAFQFLRATEDVYLQCKVLICPASDYNSRCRRGCTKRVARDVGSEHESETLVV
GPIHLLAPETKEEATDEQKET
Download sequence
Identical sequences I3IVP1
ENSONIP00000000681 ENSONIP00000000681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]