SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000860 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000860
Domain Number 1 Region: 52-250
Classification Level Classification E-value
Superfamily LigT-like 4.01e-20
Family 2'-5' RNA ligase LigT 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000860   Gene: ENSONIG00000000680   Transcript: ENSONIT00000000859
Sequence length 250
Comment pep:novel scaffold:Orenil1.0:GL831143.1:1953365:1997365:1 gene:ENSONIG00000000680 transcript:ENSONIT00000000859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIAAFILLLSVVPSQESTKKKRKRKRGDNEGRVDSEDDGDKKKKKKESQRPNYFVSIPIT
NTQISSAVSEVQEAVLQQDPRLAKAMIPVPTLHITLLVTHLANQEQVAIKATAVLAQVEP
SLAELLGGRDLVLPFSGISHFRKEVVFVGLASGQHRHTLDSLAELLRSRFEEQGLLQGDC
RGFEPHLTIMKLSRASKLRSQGIKRVDPALYSNYTDKFFGDQTVERVDLCSMLKKKQQDG
YYHTETSLQL
Download sequence
Identical sequences I3IW70
ENSONIP00000000860 ENSONIP00000000860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]