SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001144 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001144
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Cupredoxins 4.93e-45
Family Ephrin ectodomain 0.00000585
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001144   Gene: ENSONIG00000000905   Transcript: ENSONIT00000001143
Sequence length 160
Comment pep:novel scaffold:Orenil1.0:GL831153.1:2205084:2211860:1 gene:ENSONIG00000000905 transcript:ENSONIT00000001143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFWHGEYRVAVNINDYLDIYCPYYEGPPSHGRMERYILFMVNHEGYTSCQHRMRGFKRWE
CNRPTGPDGPLRFSEKFQLFTPFSLGFEFRPGHEYYYISSPHPNHVGRACLKLKVYVRPP
DGSGYDSPEPFLTDGGSSWRAGCMTLLAALASLFLGLFYW
Download sequence
Identical sequences I3IX04
ENSONIP00000001144 ENSONIP00000001144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]