SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001361 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001361
Domain Number 1 Region: 397-616
Classification Level Classification E-value
Superfamily LigT-like 4.5e-81
Family 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain 0.000000876
Further Details:      
 
Domain Number 2 Region: 266-385
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000217
Family Nucleotide and nucleoside kinases 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001361   Gene: ENSONIG00000001073   Transcript: ENSONIT00000001360
Sequence length 638
Comment pep:novel scaffold:Orenil1.0:GL831149.1:2132728:2136730:-1 gene:ENSONIG00000001073 transcript:ENSONIT00000001360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTEKSGEVLGASETPQQAETAVEKAAVETPVESTEPEKSPAAEEATGHESQVVKEMEAL
SVTDKVAMPEEKDPTEKADADSLPGAAASQQPEESSEKKISEQQPVPENNPESLALQTPL
AESSPEPAPEKAAESVPEIKVQTLPDSAVTQQSVDTQPPGPKEKEQAESVGELQKAMDTE
AEGESGAKPKEKEEAKPEETVVSDVSSEKPAEAEMLKTEASAEVGNVRPESEPQKEEDIV
PASGSLSFAFLEQEQTKDALRISRTLVVLRGLPGSGKSFLARAIADTYKDHCAVISADDH
GVKPEKPESNVEGYKALDEAVIARCADGNASSVLIVVDDTNHTQDRLSRLGEIAEENNLV
AIFLEPKTEWNRDLGQLTKKTKRGLEEAHLAAMKGPLEEVSLPLFFGWFLLTSIQDKIKC
TSMDFLKTLDTLEAFKKHLIDFSGKAEEVDLEQYFQPTGILHCTTKFCNYGKAEGAKEYA
EKQAVKDFYGSIFDLSLSALFVTPRTFGARVSLTEEQLQLWPADADAEKQAESVPAAASM
PLGSRAHVTLGCAENVEPVQTGVDLLEILTLQQEGQQGEQVEEMELGTLTYYGTGKWLLN
LREPISAPACFSSFYGRKEPEPTKKDHEKKKKPKCVIL
Download sequence
Identical sequences I3IXM1
ENSONIP00000001361 ENSONIP00000001361 XP_003442201.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]