SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001495 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001495
Domain Number 1 Region: 75-181
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-24
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 2 Region: 257-360
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.01e-19
Family Platelet-derived growth factor-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001495   Gene: ENSONIG00000001182   Transcript: ENSONIT00000001494
Sequence length 364
Comment pep:novel scaffold:Orenil1.0:GL831156.1:2122505:2169082:-1 gene:ENSONIG00000001182 transcript:ENSONIT00000001494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVVIQTVPSTALCDRRLPLIQMILPLIFLLASLLQQYGSEAESSNVSKFPLPSVKEHNG
VQDSNQEKVITVSGEGMVHSPDFPHTYPRNTVLVWRLVASSNMRIQLTFDERFGLEDPED
GICKYDFVEIEDPTEKTILGRWCGSQSLPGSHISKGSQITIRFISDEYFPSEPGFCIRYS
LLPVSEPEPKAPAVLPPSPQDIEELSEAVAELSTVEEVMKYLEPERWQMDMEELYKPTWH
VLGKSFIHSKKARGGADLNLLREEVQLYSCTPRNFSVSLREELKRTDVIFWPSCLLVKRC
GGNCACCSHRCYDCQCIPARVTKKYHEVLLLKHRSGVRGLQKSMTDVPLEHHEECACVCK
DDSD
Download sequence
Identical sequences I3IY05
ENSONIP00000001495 ENSONIP00000001495 XP_005467315.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]