SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001629 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001629
Domain Number 1 Region: 876-1014
Classification Level Classification E-value
Superfamily TNF-like 1.2e-28
Family TNF-like 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000001629
Domain Number - Region: 535-750
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00497
Family HBL-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001629   Gene: ENSONIG00000001290   Transcript: ENSONIT00000001628
Sequence length 1014
Comment pep:novel scaffold:Orenil1.0:GL831143.1:7706714:7735563:-1 gene:ENSONIG00000001290 transcript:ENSONIT00000001628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHLFYLLTFLLARACSGLGYAESTVPAGQRAASRHRNWCAYVVTRTVSCMMEDGVETYI
KPDYQRCAWGQCPRVALSYRTYRRPRYKVAYKMVTEMEWRCCHGYAGEDCHSGPQGTPET
GVTDTGYNTGGGQRGGEGEITNTSENILYLLSLSPSEVSVSFLNPGDTEKIRQLENTIHG
LTKDLNNMQTTINGINQRLYVSVVFNTRACFISWTEFSVSETLFSGNKETPDVVLGSPRP
KHEGIKTVSIPQPHMKETINSIQTKLDHLYNRTQAHDQTLLTINNHLVNGGGNELDGAGR
GGAGGDQLNILKEEILTQLERRVSLSCSSCQVGVEDLRRQQQEDRDRITALEKRISSIDQ
HLRQSLEISRSETERSQACCNTVTELGRRLSDVEVRLTSTANKCDAIKGRLDKELAGMGG
GKGRVTEDRLNGRLRELEKRMNTTMRKTEQRCTNTGNNMKETVQRDVTQLRNSVLVQLDD
HSYKIGRLTSTTDMCRDACGPNARDRTSDETVKTLTELTDLRRKVDLGESVCSQVCSNLQ
EEVGRLREDVEECTVQCKTNINDLKKRLEGHTVHSGKLGGDLKSIQGELAEVMDTFSSIN
DTLKGLGRTVQTHGHTITDLTHVKNNIIVEPGSAGSAVETAWKNRTSSVGSNHVTEIGEC
QRSSDGLDRRLSNLEKVSGRFDSFSGKLEGIKEGLDRHVSGLWNSVNGLNVTVTSQGNAI
ENIQNVQLPQIHSNIHKLNSSVVDLVRDFHRFKTQDFKGESQRAEGVGSAGKYESKGHIP
CHVSRLIVHVFRVLFRDSVTVFPGCLTKHCTPSGPPGPPGLRGEQGPRGPMGPEGRIGPQ
GRDGEQGLMGPPAYFPGLRGEQALSSGPPGSDAHVPRLSFSAALTRQMRNTGTIVFNKIF
VNENNAYNPKTGYFTAPVRGKYFFSGILTGHKNIKIEAVLSKSNIGVARADSAGYQPEGL
EKPMAETKHIPGALAVFNVILPMEEGDTVCIDLVTGKLAYSSEPLTIFSGMLLY
Download sequence
Identical sequences I3IYD9
ENSONIP00000001629 ENSONIP00000001629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]