SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001940 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001940
Domain Number 1 Region: 299-565
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-45
Family Kelch motif 0.0057
Further Details:      
 
Domain Number 2 Region: 670-832
Classification Level Classification E-value
Superfamily C-type lectin-like 1.19e-25
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 3 Region: 42-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 980-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000239
Family Laminin-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001940   Gene: ENSONIG00000001552   Transcript: ENSONIT00000001939
Sequence length 1231
Comment pep:novel scaffold:Orenil1.0:GL831135.1:9999069:10201266:1 gene:ENSONIG00000001552 transcript:ENSONIT00000001939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLVVHAEASSVSKSCDKSCFSGKCINGTCVCDHGWVGDQCQHCQGRFKLTDLSGSLTD
GPFNYKYKTKCTWLIEGFPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVFSGLVV
PETRGNETIPEVVTTSGYALLHFFSDAAYNLTGFSIAYSINSCPNNCSGHGRCSTANSVA
GRVYCECEEYWKGDACDIPYCRDNCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLSVPSTE
AFWVLPSIKPSAQSLGRASHRALVHSGLMWVVGGYSFNYSNYHMVLNYNLETSTWDVVPV
SSGPLYRYGHSLALHQDDIYLFGGKLEAGPANVTDEMWVFNIPRRTWSLRKPVPPPPYAL
EGHTAHVVELANGEPVMLIIFGYSPIYSYINKVQEYNIRSNSWQVVSSGGAVVQGGYGHS
SVYDEASGCVFVHGGYKALNNNKYGLVDHMYRYHVHTRTWLILKESGLARYLHSAVLLSG
TMLVFGGNTHNDTSLSNGAKCFSADFLTYDIACDEWTVLPRPGLHRDINRFGHSAVVSNG
SMYIFGGFSGMLLNDVLAYTPPSCQAFSSPALCAAAGPGVRCHWVKSRCVPWKPKPPDHL
FPAPFCPARPDSTDEQCFRFSDCASCTANTRGCQWCEDRKCISASSNCTVVLVNNLSRKT
KCTLNNPQENMLASCRSCSLNVNCQWESQQQECQALPGQLCGDGWHQVGEVCLRINSSRE
SYDNAQHYCKNLGGNIASLLTDKQVNFVLEELQKYQLQDKMLSPWVGLRKINVSYWGWED
ASPFTNTTLRWSPGEPSDSGFCAYLEQAQMAGLKANPCTATTDGLICEKPAGSPQSQSAR
PCKTPCALRTSCANCTSQAMECMWCGSTQRCVDSSAYVISFPYGQCLEWQTQDCTAQNCS
GLRTCAECLERVECGWCGDPSNTGRGVCMEGSYRGPLKPVTAKAGPRDRDRLRDRDLVVD
QGLCSSDRGYNWAFIQCPACQCNGHSRCVNGSVCEHCGNLTAGTHCQSCMPGYYGDPTNG
GKCNACKCNSHANVCHVNTGKCFCTTKGVKGDQCQLCDSENRYLGNPLRGTCYYNLLIDY
QFTFSLLQEDDRYYTAINFMATPEQANKNLDMSINASNNFNLNITWSLSSTAGTISGEEM
PIIARMNIKEHRDSFSSEKFNFRLHHNITFYVYVSNFSWPIKIQIAFSQHNSIMDLVQFF
VTFFSCFLSLLLVAAVVWKIKQTCWASRRRE
Download sequence
Identical sequences I3IZA0
ENSONIP00000001940 ENSONIP00000001940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]