SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002054 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002054
Domain Number 1 Region: 256-373
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.27e-31
Family UBX domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 177-271
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 6.41e-30
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0000128
Further Details:      
 
Domain Number 3 Region: 3-45
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000493
Family TAP-C domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002054   Gene: ENSONIG00000001637   Transcript: ENSONIT00000002053
Sequence length 375
Comment pep:novel scaffold:Orenil1.0:GL831362.1:852245:860946:1 gene:ENSONIG00000001637 transcript:ENSONIT00000002053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMANQEESVREFVAVTDVDEERARFFLESAGWNLQLALASFFEDGADDDIVTLPQPEGGS
SVSRSAGPSSQPRVTSFRDLMHEAEDESDEEEGQRFFAGGSERSGQQIVGPPKKKSSNEV
VEDLFKGAKEHGAVPLDRSGRGPGEPSKAKAFVGGGYRLGAAPEEESTYVAGERQASNRQ
QDFIAIKQLWKTGFSLDNGELRSYDDPGNANFLEAIRRGEIPLELRQRSRGGQVNLDMED
HRDEDFTKPKMAFKAFEGEGQKLGSATPELISAPPTSQQDQAANEAQASASVNLDPSQPV
TNIQIRLADGGRLVQKFNHTHRVSDLRHFVVAARPAMAAREFVLMTTFPNKELTDESQTL
QQANLLNAVIVQRLK
Download sequence
Identical sequences I3IZL4
ENSONIP00000002054 ENSONIP00000002054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]