SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002121 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002121
Domain Number 1 Region: 320-485,527-612,654-682,751-869
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.53e-81
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0012
Further Details:      
 
Domain Number 2 Region: 173-281
Classification Level Classification E-value
Superfamily RING/U-box 5.42e-33
Family Zf-UBP 0.00000358
Further Details:      
 
Domain Number 3 Region: 708-767
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000169
Family UBA domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002121   Gene: ENSONIG00000001692   Transcript: ENSONIT00000002121
Sequence length 872
Comment pep:novel scaffold:Orenil1.0:GL831140.1:177090:213164:1 gene:ENSONIG00000001692 transcript:ENSONIT00000002121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADLGELLVPYMPTIRVPRTGDRVFKSECAFSFDSPESEGGLYVCMNTFLGFGREHVER
HYRKTGQSVYMHLKRHVKEKATGAAGGGTIPRRRNGKVFLDLELNRDFNGEDYEYEDEAK
LVIFPDHFEIPLPNIEELPALIKEQVTIACDAVLNAPSAYKKQEPESWEEEIQVSRHARS
LRQLDNGVRIPPSGWKCQKCEMRENLWLNLTDGAVLCGKWFFDGSGGNGHALEHYRETNY
PLAVKLDTITPDGADVYSFEEEEAVLDPHVSEHLSHFGIDMLQMQKRTENGHHTDNKPRP
RVSEWEVIQESGMKLKEVYGSGYTGIKNLGNSCYLSTVMQVLFSIPDFQRMYVGNLQRIF
DYSPLDPTQDFATQMAKLGHGLLSGQYSKPPMKSELIEQHQQKGISARMLKALVSRGHPE
FSSNRQQDAHEFLLHMINLVERNSAGSENPSDVFRFLVEERVQCCQTRRVRYTQRVDYCI
QLPAPFEAASNRVPEELLAYEVKRKEAEENMRPSPEPVRARIPFTACLQAFTEPENVPDF
WSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGVDWVPKKLDVAIDVPDFLDLNRLRAT
GLQAGEEELPDLMPPIVLPEDTRVCLNILGLNMPDSFLSLINHPSTPEIDEAAVMQLAEM
GFPLEACRKAVYYTGNMGPEMAFNWIIAHMEEPDFAEPLTLPSMIDPGPSAGDSPTGAAL
LGNSPPEESIAILTSMGFPRTHSIHALKATNNNLERALDWIFTHPEEEESDALSDMADTE
PNDNAFSNANSHSDSTLSPDGDASGPRVKDGPGRYELFAFISHMGASTMSGHYVCHIKKE
GRWVIYNDHKVCLSERPPKDLGYIYFYHRLSS
Download sequence
Identical sequences I3IZT1
ENSONIP00000002121 ENSONIP00000002121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]