SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002163 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002163
Domain Number 1 Region: 621-648
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000628
Family Ran binding protein zinc finger-like 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000002163
Domain Number - Region: 12-50
Classification Level Classification E-value
Superfamily UBA-like 0.00752
Family CUE domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002163   Gene: ENSONIG00000001728   Transcript: ENSONIT00000002163
Sequence length 650
Comment pep:novel scaffold:Orenil1.0:GL831140.1:524348:530900:-1 gene:ENSONIG00000001728 transcript:ENSONIT00000002163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGGSQLDYHILQDLKQRFPEIPEGVVSQCLLQNNNNLDLCCHLLAQESNRYLYGDFHP
SPEEGRLNRNHMLHISLGYPGSDASKSNGGAGGVGRSLVHSTSDSHIDPQRPNYPEPLSA
PATMAPSPGYNPFFMNDQSRSASTPTPPPTMPGMSPTYSSVSHYTMNPITVTLSQSIPNV
PQALQIPPGHYANNTNATLYIRPSPSQSPQPAPWSSSGAPVYQHQQSPYSTPTYGSPYSS
PQHQVQAQPQPQPQLQPQLQPQLQPQHQPQPQHQHQQYVFLPISSPTLPSMPYHHQQPPQ
QQPPVYRPYQTKNLLKNQIEITLEGPRPRSNSPVHTPHPQGPLYRSPSSSPSSPSRGIAG
RPRPASSPQPGQSAYTFKIKVSPGGQAQRPLSSPPVTEAEPILNIVDQGAHNAAPAPILP
ISALPGTITSQFQPMPRRSSSGSDDYAYTQALLLHQRARMERLMKELRLEQQKLEQLKGD
VNNMEYDALQRRFRRVNSTSLIPRPEEMTRLRSQNRQLQIDIDCTLKETDLLQSRGKFDP
KAMNNFYDNIQPGPVVPPTSGKKGKHFCRSQRKTETQFNILPRCRFDGSFRSLSHIGLNS
YCLSEGTQASKRVPQTDEDFEGAQWNCESCTFLNHPALNRCEQCEMPRYT
Download sequence
Identical sequences I3IZX3
ENSONIP00000002163 ENSONIP00000002163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]