SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002271 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000002271
Domain Number - Region: 5-64
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00353
Family PB1 domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002271   Gene: ENSONIG00000001815   Transcript: ENSONIT00000002271
Sequence length 497
Comment pep:novel scaffold:Orenil1.0:GL831497.1:290993:294792:-1 gene:ENSONIG00000001815 transcript:ENSONIT00000002271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILQMDSVALKVIFGQQSEKLVLSSGIPRTVEELHETVRETFGLVEDFTLHYYDDSFGDFF
TLHSPNQIKDRGTVKAVVIPSVVLTLIPQCENPSDVSSLNESSNNTVILSPLQSPLKTAW
PDEIVIPLFSVATETVLKNANEVFVQNGTVLNNTSYTAYPTGLQIGEVAEALVKKHPCLT
EPGSRNGWMGWMYSLKYKMGNYRSKLRSLGVPEVTCNSLKNKHPDDKAPAKNIKKARKGE
VLFLPHYPGQDGKEQQELERQRLIDECKKKNSTAIKDLMCKTFAHRRHDIISQQLSVSDI
KDRWPALFDVSQVSEHLKGYPLVNKIWSVRSPIISSSRQRKSSGGQPFSRPLPVVGALLL
DLPGIIQEATGEKGLPVPQPAPPPSDDLTGRKVEEAELPEELKGFLCKAADAILNIRWFR
GQPGSASSLVIEGVTVLGKLGNLSKACCYLLGLCYALDLKYPKNLKCTFEAFQKVFMELD
PGNLSVKVQRLKNDLCS
Download sequence
Identical sequences I3J081
ENSONIP00000002271 ENSONIP00000002271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]