SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002281 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002281
Domain Number 1 Region: 114-386
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-73
Family Protein kinases, catalytic subunit 0.0000000406
Further Details:      
 
Domain Number 2 Region: 375-432
Classification Level Classification E-value
Superfamily SH3-domain 0.0000794
Family SH3-domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000002281
Domain Number - Region: 654-694
Classification Level Classification E-value
Superfamily UBA-like 0.00485
Family UBA domain 0.05
Further Details:      
 
Domain Number - Region: 6-67
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00785
Family SAM (sterile alpha motif) domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002281   Gene: ENSONIG00000001824   Transcript: ENSONIT00000002281
Sequence length 753
Comment pep:novel scaffold:Orenil1.0:GL831497.1:443989:458965:1 gene:ENSONIG00000001824 transcript:ENSONIT00000002281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMDQDTQWLYQLLAEVQLEKFYLRLRDGLNITRIEHFSYVKEADLEQIGISKPGQRRLW
EALKRYKTSARGRSWVPKVFSGRGSDGGEQLTGGGQAQGQEVGVRALPCLIQDSELILAE
RLGSGSFGVVKRGEWHTPTGRVLPVAVKSLRSSMSRQADTLKDFLQEVTVMQSLDHPNII
RLYGVVLTQPLKMVTELAALGSLYDTLRARQYEYSLVRLWLFATQIVSGMEYLESRRFIH
RDLAARNVLLASKDMVKIGDFGLMRGLNQEKDHYIMSAHRRIPFAWCAPESLRVGSFSLS
SDVWMFGVTLWEMFTYCEEPWFGLSGRQILWRVEREGERLEKPQDCPQEIYAVMRKCWAC
NPTDRPSFAQLTAMVAEAKPREVQAIREFAEPRKLALLPNDLVTVIDHSLELSEWRGQNQ
RTMAIGWFPASLTVPSLPSGAAVSSSSSGPNPGGYISTPVKGSLQHTGHGDVNPDHSWGT
PVTLDEAGGGWRSGPGREKEGSNLQKMAAMTRSLESVLGGHRPRAQTVGMFRVDQHGKLL
PPVMPAHSAVMQQDPRRLSEASIVPPPRPPPPNLKVLRKIQRRPTINQAQGNALPQQMVP
SALIQTQPQPQQVVGGSNLTKMAQLARSTPQLDEYSDSRERDRERIREREKVPQNTREGL
IAQVMEAVHGVTTDEVHNALQRNEWNPVRAEQQLKMEQLYSLSLCSREDCVKILAKYQWN
LQMASRYLIRLTASDRAGPPERDRPLISPERRV
Download sequence
Identical sequences I3J091
XP_003459201.2.78416 ENSONIP00000002281 ENSONIP00000002281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]