SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002284 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002284
Domain Number 1 Region: 198-312
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-35
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 2 Region: 384-507
Classification Level Classification E-value
Superfamily TIMP-like 1.13e-34
Family Netrin-like domain (NTR/C345C module) 0.00016
Further Details:      
 
Domain Number 3 Region: 76-188
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002284   Gene: ENSONIG00000001827   Transcript: ENSONIT00000002284
Sequence length 507
Comment pep:novel scaffold:Orenil1.0:GL831223.1:1040764:1047922:1 gene:ENSONIG00000001827 transcript:ENSONIT00000002284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSNCFNTPLLFCLSRPFTTSHLLPRCCSLLTPQQHMSHIWGLSLLLSLSLLASVSGTQY
QSQSESNSYLMPVFYCGGDMVAESGLVGSEGFPSFYKPNTKCTWRITVPEGNVVTLSFRI
FDLEADSQCRYDYLDVYNGHSNLVQKLGRFCGTFRPGALISTTNMMMLEMVTDDETQSRG
FLAYFTAVKPYVSDQQFCGGRITKAQGEIKTPNWPDKKYDPGTSCSWLITVDPNMVIHVN
FDKFALEDDAYCRFDYVAFFNGGERDDSRLIGKYCGDQVPEPIVTSGNVLLVQFVSDLSV
TSDGFLARFTSIPRGSHIPTVNSGQTTRYSPPVPPVKPAHPSTPIEATTKYVPAPVPRST
PSPKPVKTARDPNAKSNGKRPVPQNPLCAKACKRNGTIKTSFCASEFVLTGKVTSVAPRP
RGTLQITVSLIKAYKAGRLTITQVGETMSVKLMSQCKKCPLLRKGVNYIIMGQVNEQGQG
ILEPGAFTALYKPPHHKLLVNISKQPC
Download sequence
Identical sequences I3J094
ENSONIP00000002284 ENSONIP00000002284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]