SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002442 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002442
Domain Number 1 Region: 450-562
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-23
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 632-739
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-22
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 3 Region: 745-810
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000278
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 805-868
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000082
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 391-454
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000012
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 567-631
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000101
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 873-931
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000055
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 8 Region: 283-392
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000589
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002442   Gene: ENSONIG00000001950   Transcript: ENSONIT00000002443
Sequence length 937
Comment pep:novel scaffold:Orenil1.0:GL831223.1:1952694:2042542:-1 gene:ENSONIG00000001950 transcript:ENSONIT00000002443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVKQGCQFQTLCTVLLLAATVAEIRGQVAKDSNSISKRTLDLDRDLFTHSSMQDTESEV
HSITTVSPMNIPNHQPVFKGLLLHEHLLTRDFQGDQHFFRKDGSVAAYPTMPGSVSAPNA
ADLVTQLVPHEDAPAFSDIASTATVAATSPLTTFSPTTPALPVSMPQKKSKERTRGTDKV
EPTTHSLTTQVTPNNRGSGGENSGVHPSSSLGSQPQSLGAFPEEATSGKMEKGEASETAL
KNKTSPGHQLHKLTPASSEKDTTTMSTTVTTTTTITTMQTSEPCSLNFTDPEGNIEILQQ
VDSGVECNYLITVYLGYGIEVQVLNVSVLEGEQVTVEDTGGQEPFILANESVLMTGLVLR
SWSNQISISFRSEKRRNSAYLLLHYQAFVLSCAFPKEPAGGEVSVTHLHPGGEAYFHCFT
GYKLQGPKMLTCRNATTPYWSGKEPRCVASCGGMIKNATYGRIVSPGFPGNYSNNLTCHW
VLEAPEGHRLHVHFEKVALAEDDDRLLIKNGNNIDSPPVYDSYEVEYLPNEGVLSTGRYL
FVEFTTDGTMTSTGAAIRYEAFAKGMCYEPFVKYGNFSSSDSTYSVGAVVEFSCDPGYTL
EQGSVVIECVDAQNPQWNETEPACRAVCSGEITDSAGVVLSPNWPEAYDKGQDCIWGIHV
EEDKRIMLDIQVLHLGKNDLLTFYDGDDLTANILGQYSGTRPHFKLYTSMADVTIQFQSD
PATNIYGYNNGFVVHFFEVPRNDTCSELPEITNGWKSMSHPDLIHGTVVTYQCYPGYTLV
GSEILMCQWDLSWSGDVPKCEEVMTCQDPGNVQHSRKVITGSRFAVGSTVQFICNKGYIL
SGSSLLTCYNRDSAMPKWSERLPKCVPEKYEPCRNPGAASTSMQSSEKAFYQAGEMLTFS
CHPGYELQGYATIYCVPGHPSQWNSTPPACRGKPRNL
Download sequence
Identical sequences I3J0Q2
ENSONIP00000002442 ENSONIP00000002442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]