SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002754 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002754
Domain Number 1 Region: 841-898
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000924
Family UBA domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1374-1450
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000149
Family Canonical RBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002754   Gene: ENSONIG00000002210   Transcript: ENSONIT00000002755
Sequence length 1569
Comment pep:novel scaffold:Orenil1.0:GL831257.1:1316917:1338528:-1 gene:ENSONIG00000002210 transcript:ENSONIT00000002755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGANSQTGHFPANHLSSKANSGPSPANHTGTSMLSGQVATSRSWGPGAVSSHCPPQSS
MGSETKSDSPGGGGGSTRGWGPPSSSTTNFNLNLNPNANPSAWPMLGHDGSGTGGGSSGG
ANTISPPHSTPNLCNPPGPPPAQTSTCTGANTNSNSSGIGNAWVTMMASDAEPHPSPSTN
VSFSSEPQNLKTDGPNHTNKQEPPSPIRSLPGWGSAPVGLGSMTQPPPGGSQVNGEDGNS
VWGNSGNSKAISSKEAPGWSHEGDGTGNSGGWGEHPEETQGGWDTPSSPAQDSQSISWSR
AVSTAGASEGSSDSMEGNPQRKDRSSREKSAPLMPAQDLDPRVLCNSGWGQTPVRQHTSW
DMDDTKHKSDVGTGSWGSGSTTPADAQGPSNTSTGPSQMTDSGSKNDAPGSQGTSGWGGN
IAATNQPSSGWGEPPSNIKPPGGPGGWGNPPPGGPSTSIPKNGGQSWGEKPSGWDDSHIK
SGSQNWGEQPKASHTWASSGVSNNTAEWGDSEESKKSPTNAWEGEPRGWGMSSQGPGGNG
GWGESLPQRPSGPSQGWGGKPQDGLSGNNGGGSMGSWGGSGSVKQGPGWGGNKQESSTEP
TGWEEPSPPSIRRKMEIDDGTSAWGDPGTYNKAVNLWDRNNSGSSQAKVTTGGNNPPSTN
NNHPHPLNHPYHGPPAPLQNHSQNSQNSGPTSGPLDPTVQHQPGASHNRGPLMAQGWGEI
SSSHTKSESSWGEPASSPVSVDNGTSAWGKPSGNCGGWGESNPESYGRGNPTMTPASCKP
APKPMQDGWGGGGEDLSLSGGQWDAEEVDMWNSTASQESNSSCNSWSNANKKAPPKGKIP
GKQDEVWIMNRLIKQLTDMGFPRDPAEEALKSNNMNLDQAMSALLEKKTELDKRGMGIAG
HDYNNGLINKPMSCPRPPLLSKDPSADPRLPFMDKVQSGMFGGGGAAQVRAMPQPQPPPQ
PPVPPLSSSQPSLRAQVPQFLSPQVQAQLLQFAAKNIGLNPALLTSPINPQHMTLLNQLY
QLQLAYQRLQIQQQMLQAQRNVSGPIRQQEQQVARTINNMQQQIQQHQRQLAQALLMKQQ
QQQPPPSHSGLHPGGAKSSLDSFPGHPQAPGLPDLQTKEPQSSPNTYSPYSLSGLNVNCM
EVGSLSMKEPPQPQSRLSQWTHPNSIESLSGNSSPLEPNLGKHGANLGPPGKPTQLDESY
SPYSLISSSESPSSPLVPPDSWGQSKGSSDKMANGTNINWPPEFCPGVPWKGLQNIDPET
DPNVTPGSVPSGPTINTNIQDVNRYLLRDRSGGKLSEMKSTWSPGPISHSQASLSHELWK
VPQGPRSSTTAPSRPPPGLTNTKPSSTWGGSSLGLGQGWSSSYTTAGTTWSTDSSTRTSS
WLVLRNLTPQIDGSTLRTLCMQHGPLITFHLNLTQGNAVVRYSSKDEAAKAQKSLHMCVL
GNTTILAEFAGEEEVNRFFAQGQSLGGTTSWQATPGTNQTRMGGTGSGASHPIGHSPHWN
NNNNGAGSSSSSGSLGAGGTKTGGELLWGGVQQYSSLWGPPSGEEGRVMGSPTPINTLLP
GDLLSGESM
Download sequence
Identical sequences I3J1L4
ENSONIP00000002754 ENSONIP00000002754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]