SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002846 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002846
Domain Number 1 Region: 628-751
Classification Level Classification E-value
Superfamily PH domain-like 0.000000152
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000002846
Domain Number - Region: 999-1077
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00641
Family Regulator of chromosome condensation RCC1 0.061
Further Details:      
 
Domain Number - Region: 232-360
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0497
Family Regulator of chromosome condensation RCC1 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002846   Gene: ENSONIG00000002280   Transcript: ENSONIT00000002847
Sequence length 1193
Comment pep:novel scaffold:Orenil1.0:GL831257.1:1775736:1788324:-1 gene:ENSONIG00000002280 transcript:ENSONIT00000002847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPITLLWAVDVYGRVYSLSTAGQRWERADDSLLELKRVSAGKGRCWGIGCDHHVYLNMMP
SETPIRYREETYENQRWNPVDGFTDTLLPTDRWPWSDVTGMNPQPLHSFQLPSRSWEWEG
DWYVDHTCGGEPSQTGGWEYAVDFPANFSPDKKWNSCVRRRRWIRYRRYIAQGTWAKIPL
DNPRKPPLPLCDISCGGWEMSDQSGRYPYLWSVSQQGQVWFREGIHPRVPEGTSWEEVEV
PKEVAQISAGPGDLLWALLWDGNLLARTGLSLDSPTGTSWLEVESPGKEIEALHVAVGVS
VVWVVTKDYKVWFRRGVNSHNPCGSGWISIGGEMMMVDVGLNDQVWAVGEDRGLYFRIGV
TPSEPSGNGWIPVSAKWGNSKEVIPPRDDCEFNGQLTEASQGSVLSCTDSDSELGPADPQ
NSTSNTPVLEAEAPSVVPLGGSDSPTPPQEKEDAPLAPQTNAPKPFIPASDSFINSLVSD
RDRTSTLQPSITEMPQEEREEPPPAPVLQTPDAGGHDVPWMNVDLEGAEAARGAQAAGPS
AGDGSAAATYALGTLESSRGVGEEEGPVWAWISGGGCDVDASSQISWLSPAGPLTTSLSL
TPVQSAAWSKQPQQQEHREEISKKPLERSNSVWVRKGTLRWWRDWKPQRWIDVAVALEQS
TKSDGRKDSIFFVYYTQYDEKKYLHVFINEVTALVPVLRDCHYAFAVYTAERTKQRWPLV
LAAQSEKDMSDWLCLLSDCCCECRGITGPPSRQALWSTTSKGDIMVHEPSLSLEAPAHAM
ACDLMFWRQIHGHLRCVESNSLGLVWGIGWDGTAWVYSGRCEQQPNPGGAVQMHQQTDVR
SVHVYENQRWNPMTGYTDKGLPTDRPMWSDESGLKECIKGSTYPPSPQWSWVSEWAVDYS
VPGGTDKEGWQYAADFPTMFHGHKTIKDFVRRRRWTRKCKITLQAPWKQVPPIRLSDISL
MPCLAQSKMEQVPVWALSDKGDVLCRLGVSLQNPAGSSWLHVGTDQPFKSISIGGANQVW
AIAKDGAVFYRGSVSPQNPAGECWYHIPSPLRQTLRQLSVGRTSVFAVDENSNLWYRQGL
TPSYPQGSAWELISNNVTKVSVGPLDQVWIIADGVPGFPAETPGAVCHRTSVGPMQPKGL
SWDYGIGGGWEHISVRGNSAEAPRGPHPPLAGPSRSPIHPQRPTQANGSATSV
Download sequence
Identical sequences I3J1V6
ENSONIP00000002846 XP_005457822.1.78416 ENSONIP00000002846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]