SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002870 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000002870
Domain Number - Region: 261-389
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0127
Family beta-lactamase inhibitor protein-II, BLIP-II 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002870   Gene: ENSONIG00000002298   Transcript: ENSONIT00000002871
Sequence length 535
Comment pep:novel scaffold:Orenil1.0:GL831233.1:2675378:2687936:1 gene:ENSONIG00000002298 transcript:ENSONIT00000002871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKNNLIAMDLLVLLLLCTAPLIRGYRSGLVIDSCEDMQLHHSGLSPQTAPSPFTVTTEHK
RYRLGEDVKVELQGPVSTPFTGFLLEAIEGGSETPVGSFAIPAGAAKLLTCSQRPNSAVS
HTSGFNSSYIQVTWRSEPSGDIKAVQFRASFVQNSTTFWVNVTSPVLTFTNARVARSAGA
LTGSGSTDPAPLVKSAASISSAECGVTKVCFSQPSNCDPAVSSSCYFMSAMMLPGGTAAC
YQMTGPYEGYIAFGFSADQSMGNDIYVCGMNSSGHVGVQHMYSTGQTTLQARPLGNVYNV
TTSLQNGVISCSFTTTNIISIQGTSDFNQSYYLLFVYGPSSNGQIQKHTGDFVSTNKMDI
STPVVVSQDAHPDIVKAHGALMLIAWMTTGTLGMMVARYLKKMAKEPRMCNKDLWFVVHV
GVMCLTVAATIIAFILAFSHAKNWSGGAHPVLGCLVMILSFFQPIGALLRCGPQHHLRYL
FNSSHFLNAVIIKSLAVAAIFTGLGRIDSSDGWLMKVMGGFLAWEALFIIMLEIH
Download sequence
Identical sequences I3J1Y0
ENSONIP00000002870 ENSONIP00000002870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]