SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002907 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002907
Domain Number 1 Region: 21-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-33
Family Spermadhesin, CUB domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 183-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.0000163
Further Details:      
 
Domain Number 3 Region: 134-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000018
Family EGF-type module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002907   Gene: ENSONIG00000002324   Transcript: ENSONIT00000002908
Sequence length 305
Comment pep:novel scaffold:Orenil1.0:GL831166.1:3361126:3365123:1 gene:ENSONIG00000002324 transcript:ENSONIT00000002908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGLYVVALFSLLHVSLSVEMTGLYGSFTSPNFPQPYPDNQHVVWNITVPDGHRVKLYF
THFSMELSDQCEYDYIQVLAEGNETLRFCGEEEKNHESTPRNTIILSARNLMSVVFRSDY
SNEGRFTGFQAFYTSEDINECLSKVEGERVCDHFCHNYIGGYYCTCRQGYLLHDNRRSCT
VPCQSQVLTSPSGVLTSPGYPNPYPPMSRCNHTIRLPEGSRIILNFLETFDIEGHPQAPC
PYDMLKISTAGKEYGPFCGPTPPDRIDTGSYDVHVEFRSDSSGKNKGWKIKYTSTETETL
TLTSD
Download sequence
Identical sequences I3J217
XP_003444948.1.78416 ENSONIP00000002907 ENSONIP00000002907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]