SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002957 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002957
Domain Number 1 Region: 52-99
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 1.24e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 253-301
Classification Level Classification E-value
Superfamily UBA-like 0.0000000051
Family UBA domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002957   Gene: ENSONIG00000002365   Transcript: ENSONIT00000002958
Sequence length 448
Comment pep:novel scaffold:Orenil1.0:GL831140.1:4533526:4536951:-1 gene:ENSONIG00000002365 transcript:ENSONIT00000002958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRPELPTASSASQVHPGAAAAAAAASIPVSMAGNLLRGPPLLLRAADKYPRTPKCARC
RNHGVVSALKGHKRYCRWKDCMCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQLLY
GTAEGLAIAAANGIIPPRPNYEVFGSVSSESNSDSSIQKYELFPKNQLSGSATPQPSAGK
PASTEGDSAPGISSPDGRHGGSGSENGDSESFISSPVSKPLKDGEETPGSVSSIGSDSGS
ETDKDDQEPSPSSAASRHMNAIDILTRVFPSHKRSVLELVLQGCGKDVVQAIEQILNNSG
AQGPNKAGPDETWTAERMLQNAQQPPAASATTTAPTRPMLPGAMTLSNRSAFSPLQPNAP
HFGADPSTYPLGTHLGLNPLRLAYSAHSRGLAFMTPYSTTGLMPTLGFRPPMDYAFSDLI
RDRTMLHKEQGYASGLYGPLVNNTPEKQ
Download sequence
Identical sequences I3J267
XP_005479065.1.78416 ENSONIP00000002957 ENSONIP00000002957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]