SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002958 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002958
Domain Number 1 Region: 553-669
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-30
Family UBX domain 0.0000552
Further Details:      
 
Domain Number 2 Region: 352-506
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000015
Family Thioltransferase 0.041
Further Details:      
 
Domain Number 3 Region: 119-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000636
Family Ubiquitin-related 0.013
Further Details:      
 
Domain Number 4 Region: 205-279
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000259
Family Ubiquitin-related 0.02
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000002958
Domain Number - Region: 8-44
Classification Level Classification E-value
Superfamily UBA-like 0.0102
Family TAP-C domain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002958   Gene: ENSONIG00000002366   Transcript: ENSONIT00000002959
Sequence length 671
Comment pep:novel scaffold:Orenil1.0:GL831140.1:4549412:4608337:-1 gene:ENSONIG00000002366 transcript:ENSONIT00000002959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESGDSNMDREMILADFQACTGIDNIAEAITLLELNNWDLVAAINGVIPQENGILQSNFSS
EASQATMYGPPSLSEAADAAAGSAVPPPSSSSSSSSPPSSSASAFCPITPSSRHIVERQP
RLLNFRVEYRQRSVELVLEEGNTVGEIKQILETELGVPVSKMQLKGWKSGDVSDSTVLRS
LHLPKNNSLYVLTPDIAPTASTSKNSALQDSLNQNFLLVISHREAQRDYNLNFPGSRTIQ
EVKRNISDLTNIPVRHQQWEGWPASASTDSMTLALSGISYPCHHLSVCRRSSPANAQEPT
EECADVHMISDSEGDDYEDASEFGVDDSEMFGVGSSSCRKSPMMPENSENETDALIHFTS
EFSSRYGETHPMFFIGSLEAASQEAFHGKARDRKLLAIYLHNDDSVLSNVFCSQMMCADS
IVSYLSQNFITWAWDVTKEANKSRLLTMCTRHFGSVVTQTIRTYKTDQFPLLLIVMGKRT
SNEVLNVIQGNTTVDELMMRLMGAMEIFTAQQQEDIKDEDEREAREMVKREQDEAYRLSL
EADRKKREAQEREEAEQFRLEQMRKEQEEEKEAIRLSLEQALPPEPDEESGEQISKLRIR
TPSGEFLERRFLGSCKLQVLFDFVASKGYPFEEFKLLTTFPRRNITQLDPGSTLLEAKLF
PQETLFLEAKE
Download sequence
Identical sequences I3J268
ENSONIP00000002958 ENSONIP00000002958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]