SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003004 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003004
Domain Number 1 Region: 12-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.91e-21
Family Ubiquitin-related 0.0001
Further Details:      
 
Domain Number 2 Region: 529-579
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000109
Family UBA domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003004
Domain Number - Region: 205-255
Classification Level Classification E-value
Superfamily ARM repeat 0.00293
Family Mo25 protein 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003004   Gene: ENSONIG00000002403   Transcript: ENSONIT00000003005
Sequence length 583
Comment pep:novel scaffold:Orenil1.0:GL831161.1:1681672:1691039:1 gene:ENSONIG00000002403 transcript:ENSONIT00000003005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQGAADPGNNNNNKPEASEGTIIKVTVKTPKDKEEIAIAEDASVTQFKEEISRRFKAK
QDQLVLIFAGKILKDGDSLSQHGIKDGLTVHLVIKTAHKAADGGSTSASSSTSTQAGSTS
TSNPGTSPSTTTGSTGSAPPPTQTPNILTGFGDLAGLAGLGMGSANFMELQQQMQRQLMS
NPEMLSQIMENPLVQNMMSNPDLMRQMIMANPQMQQLMERNPEISHMLNNPELMRQTMEL
ARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMFSAAREQFGSNPFSALGG
SSESGAQPSRTENREPLPNPWGPPASSNPSESGGGSTGSSSTTAGTTPSVSNPLGINPGS
LGNGMFNSPGMQSLLQQISENPQLMQNMLSAPYMRSMMQSLAQNPELASQVLMNNPLFAG
NQQLQEQFRAQLPIFLQQMQNPEALSVMTNPRAMQALMQIQQGLQTLQTEAPGLMPSLMS
GGIPGIPTGGAMPTENPASSPSSAGTNTAQQQLMQQMLQMFAGGGGGGGGSATTQTPEVR
FQSQLDQLNAMGFINREANLQALIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences I3J2B4
XP_003444104.1.78416 ENSONIP00000003004 ENSONIP00000003004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]