SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003134 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003134
Domain Number 1 Region: 92-456
Classification Level Classification E-value
Superfamily ARM repeat 1.33e-103
Family Diap1 N-terninal region-like 0.00000000843
Further Details:      
 
Domain Number 2 Region: 705-1033
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 4.71e-100
Family Formin homology 2 domain (FH2 domain) 0.000000001
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003134
Domain Number - Region: 431-547
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0366
Family HBL-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003134   Gene: ENSONIG00000002501   Transcript: ENSONIT00000003135
Sequence length 1123
Comment pep:novel scaffold:Orenil1.0:GL831169.1:1903512:2249163:1 gene:ENSONIG00000002501 transcript:ENSONIT00000003135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQASGGEDPNKPSKKKSSEDEGKNKKLNIHIKTLADDMRDRITSFRKTGTKKEKPLIQH
PTDPLSTQTELPVPQPLFDERSMNLSEKEIIDLFEKMMEDMNLNEDRKAPLREKDLSTKR
EMVVQYISATAKSITGSKVAGGLRNSKHECTLSSQEYVHELRSGITEEKLLNCLESLRVS
LTSNPVSWVNNFGHEGLGLLLEALEKLLDKKQQEPIDKRNQHKLIQCLKAFMNNKYGLQR
ILGDERSLSLLARAIDPKQTSMMTEIVKILSACCIIGEENILDKILAAMTIAAERNNKER
FAPIVEGLENHEAQQLQVACMQLINALVTSPDDLDFRIHLRNEFLRCGLKKILPELKETE
ELDIQLRVFNENKEEDSIELSHRLDDIRAEMDDMNEVYHLLSNMVKDTASETYFLSILQH
LLLIRNDYYIRPQYYKVIEECVSQVVLHRSGMDPEFVYNKRLDVDFTHMIDQLVDKAKVE
ESEQKATEFSKKFDEEFSARQEAQAESQKKEEKIKELEGKIQALESQIAAGLTATGAPPP
PLPGGAGVPPPPPPPPPPPGGVPPPPPPPPPLPGHACIPPPPPPPPPGGGPPPPPPPPGC
GPPPPFGGPPGPPPPPGFPVVKLPYGLEPKKTYKPETVMKRVNWSKIVPQEMAENCFWIK
VKEEKFENPDLFAQLSLCFSSQSKVRKDLKDENEEKVPQFKKKAKELRILDAKTAQNLSI
FLGSFRLPYEEIRDIVLQVDEERLSESLIQNLIKNLPEQKELNALAELKGEYEELVESEQ
FGIVMSSVKLLRPRLNGILFKLTFEEQVNNIRPDIMNVTFACEEVKKSEGFSKLLELVLL
VGNYMNAGSRNAQTFGFNISFLCKLRDTKSVSQNTTLLHFLAEKCEESYSEILRFPDELE
HVENASKVSAEILKSSLTNMERHIQRLENDIENFPKTDDEQDKFVEKMSGFSKSSREQYE
KLSTMHKNMQKLYESIGSYFAFDPHSVSVEEFFGELANFRMLFMEAVKENHKKREMEEKI
KRAKLAKEKAEREKQERQQKKKQLIDMNKEGDETGVMDSLMEALQSGAAFRDRRKRTPRN
GDQSPTSPAPWWSGANYGNRTLDNRRAVLERSRSRHNANHQAR
Download sequence
Identical sequences I3J2P4
ENSONIP00000003134 ENSONIP00000003134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]