SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003216 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003216
Domain Number 1 Region: 15-186
Classification Level Classification E-value
Superfamily RUN domain-like 6.93e-26
Family RUN domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003216   Gene: ENSONIG00000002568   Transcript: ENSONIT00000003217
Sequence length 1002
Comment pep:novel scaffold:Orenil1.0:GL831309.1:21:25938:-1 gene:ENSONIG00000002568 transcript:ENSONIT00000003217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIMAEGEAEERRCRKEHWKLLSSLKTTVEGLLSTNNPNVWSRYGGLQRLHKDMNNILSH
GLRNEQVQVYYKQRNYWPFVWCVRYISPQLASHVEQVQFRHLEPVLSSGIKSAGESYKAE
RWLLHSLQVHMLSAQLRPLLKHLGHMRKYYNGADDAFLLSEPHVTAMFQCLEAVEQNNPK
LLAQVDTVGVQLSPLKAPPCLGLLKSQSLCVLPGSGGAWRNADKAPSRESLSRRLTTSNC
SLREAVATSQNSASTTAAESPNSSSTSADTTSQTSSLESQWVVVTRPGENARGASPPPGS
ASIPSISLTDTNSTSSFLQSEADEYGGGGDSDDGPEYLAIGNLGQRNGRRNSQSSTHSSE
RGENTDQSLQRSSTTQAPQRRSSFSEGQKGPGRGLKGHTRSFSDTGVNQKLRNGAESAGE
DCCMKDYSPFSPQHSDTSTSSSLYMESRADGSQYSSTSEGMFRRPSEGQSLISYLSEQDF
GSCADLEKVQENAHFSISESLIAAIELMKCNMRRQEEGEEEGDSDSEIQQLKQKIRLRRQ
QIRRSRLPPSANSQHGAAFHSTDSGGSRRSSQDSSQGLSDSGSAEEVEECELRGTDGCEG
QSLLAMSQNGLSLSLASLFSGIDADIKPSVSSSGRSFLSSDSLYSSTPSFLQSNSAESVA
MGLLRQFEGMQLPAASELDWLVPEQDAPQKVQLLPIPDSLPISPDDGEHADIYKLRIRVR
GNLEWAPPRPQIIFNIHPAPKCRRKIIVAKQNYRCAGCGTRIDPGTDYIKRLRYCEYLGR
YFCQCCHENAQAVVPGRVLRKWDFSKYYVSNFARDLLSKISGDPLFNLNDINSGLYKKNK
SLETVRVKVLRMQLFHMKNLFKTCRLAKEYSLLDQFDSLPGHLTEDFHLFSLNDLTAVRN
GELGSRMKELLKLGTMHVANCVVQLCQAKGFVCEFCGNDKDIIFPFHLSKCQRCEGADCH
ACYHRTCFRTGKGCPRCQRLADRRERMARKNMEEQEDEGGGA
Download sequence
Identical sequences I3J2X6
ENSONIP00000003216 ENSONIP00000003216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]