SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Oreochromis niloticus 69_1.0 > ENSONIP00000003239

Domain assignment for ENSONIP00000003239 from Oreochromis niloticus 69_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSONIP00000003239
Domain Number 1	Region: 93-254
Classification Level	Classification	E-value
Superfamily	DNase I-like	4.45e-26
Family	DNase I-like	0.03
Further Details:

Domain Number 2	Region: 17-57
Classification Level	Classification	E-value
Superfamily	UBA-like	0.000000138
Family	TAP-C domain-like	0.013
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSONIP00000003239 Gene: ENSONIG00000002586 Transcript: ENSONIT00000003240
Sequence length	261
Comment	pep:novel scaffold:Orenil1.0:GL831161.1:2661420:2663596:-1 gene:ENSONIG00000002586 transcript:ENSONIT00000003240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MASTSESDTPSVSNLEEKRSHLCNEFAAIAGTDSAVAQCYLAENDWEMERALNSFFEADM ERVFDVEELPEKDTTPKAKSIDLTADSPATTKKPSEEDDGKLSLITWNVDGLDTDNIAER ARGLCSYLVLYTPDVVFLQELIPPYVQYLKKRAVSYLMIEGGEEGYFTGMLLKKSRVKFV ESEIVVYPTTQMMRNLLVAQVIVNSQKLCLMTSHFESCKGHAAERMKQLHVVMQRMSEAP DDVTVVFGGDTNLRDAEVRHC
Download sequence
Identical sequences	I3J2Z9 ENSONIP00000003239 ENSONIP00000003239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]