SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003239 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003239
Domain Number 1 Region: 93-254
Classification Level Classification E-value
Superfamily DNase I-like 4.45e-26
Family DNase I-like 0.03
Further Details:      
 
Domain Number 2 Region: 17-57
Classification Level Classification E-value
Superfamily UBA-like 0.000000138
Family TAP-C domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003239   Gene: ENSONIG00000002586   Transcript: ENSONIT00000003240
Sequence length 261
Comment pep:novel scaffold:Orenil1.0:GL831161.1:2661420:2663596:-1 gene:ENSONIG00000002586 transcript:ENSONIT00000003240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTSESDTPSVSNLEEKRSHLCNEFAAIAGTDSAVAQCYLAENDWEMERALNSFFEADM
ERVFDVEELPEKDTTPKAKSIDLTADSPATTKKPSEEDDGKLSLITWNVDGLDTDNIAER
ARGLCSYLVLYTPDVVFLQELIPPYVQYLKKRAVSYLMIEGGEEGYFTGMLLKKSRVKFV
ESEIVVYPTTQMMRNLLVAQVIVNSQKLCLMTSHFESCKGHAAERMKQLHVVMQRMSEAP
DDVTVVFGGDTNLRDAEVRHC
Download sequence
Identical sequences I3J2Z9
ENSONIP00000003239 ENSONIP00000003239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]